PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA65G00368
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family bZIP
Protein Properties Length: 190aa    MW: 22795.9 Da    PI: 6.3411
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA65G00368genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_146.67.5e-1582132555
                 CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 
                 +++rr+++NRe+ArrsR RK+  ++eL   v  L + N++L+++l++l++ 
  AA65G00368  82 RKQRRMISNRESARRSRMRKQRHLDELWSQVIRLRTDNHSLIDKLNHLSES 132
                 79**********************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.0E-1478142IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.64580132IPR004827Basic-leucine zipper domain
PfamPF001702.0E-1282134IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.88E-1382132No hitNo description
Gene3DG3DSA:1.20.5.1705.1E-1382132No hitNo description
CDDcd147029.16E-1983134No hitNo description
PROSITE patternPS00036085100IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 190 aa     Download sequence    Send to blast
MNTIPANFTG NFHYLSPENH YKTPILEATE EYILNNYNYS SSSNGQDLIT SNTSSTSDED  60
HHHYYHDHHD HHHDNKMIID ERKQRRMISN RESARRSRMR KQRHLDELWS QVIRLRTDNH  120
SLIDKLNHLS ESHQLALKEN IKLKEETSDL KQLITFLKSN NNNNIEINDY YYSKYDEDNT  180
EFIKDFEDSI
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
194101RRSRMRKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00647PBMTransfer from LOC_Os02g49560Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002892761.15e-65bZIP transcription factor family protein
SwissprotQ9FMC25e-32BZP43_ARATH; Basic leucine zipper 43
TrEMBLD7KQH36e-65D7KQH3_ARALL; BZIP transcription factor family protein
STRINGscaffold_101520.12e-64(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28922469
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13600.19e-61basic leucine-zipper 58